Anti-LAMP3 (Lysosome-associated Membrane Glycoprotein 3, LAMP-3, Lysosomal-associated Membrane Prote

Anti-LAMP3 (Lysosome-associated Membrane Glycoprotein 3, LAMP-3, Lysosomal-associated Membrane Prote
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
128995.50 50 µg - -

9 - 20 Werktage*

850,00 €
 
May play a role in dendritic cell function and in adaptive immunity.||Applications:|Suitable for... mehr
Produktinformationen "Anti-LAMP3 (Lysosome-associated Membrane Glycoprotein 3, LAMP-3, Lysosomal-associated Membrane Prote"
May play a role in dendritic cell function and in adaptive immunity. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPRQLSAAAALFASLAVILHDGSQMRAKAFPGTRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Schlagworte: Anti-LAMP3, Anti-CD208, Anti-DCLAMP, Anti-LAMP-3, Anti-DC LAMP, Anti-Protein TSC403, Anti-Lysosomal-associated membrane protein 3, Anti-Lysosome-associated membrane glycoprotein 3, Anti-DC-lysosome-associated membrane glycoprotein
Hersteller: United States Biological
Hersteller-Nr: 128995

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Full length human LAMP3
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-LAMP3 (Lysosome-associated Membrane Glycoprotein 3, LAMP-3, Lysosomal-associated Membrane Prote"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen