Anti-Lactoperoxidase

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ6775 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Lactoperoxidase is a peroxidase enzyme... mehr
Produktinformationen "Anti-Lactoperoxidase"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Lactoperoxidase is a peroxidase enzyme secreted from mammary, salivary and other mucosal glands including the lungs, bronchii and nose that functions as a natural and the first line of defense against antibacterial and antiviral agents. Lactoperoxidase is a member of the heme peroxidase family of enzymes. In humans, lactoperoxidase is encoded by the LPO gene. This gene encodes a member of the peroxidase family of proteins. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Following its secretion from salivary, mammary, and other mucosal glands, this enzyme catalyzes the generation of the antimicrobial substance hypothiocyanous acid. This gene is present in a gene cluster on chromosome 17. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. Protein function: Heme-containing oxidoreductase which catalyzes the conversion of thiocyanate (SCN(-)) into antimicrobial agent hypothiocyanous acid (OSCN(-)) in the presence of hydrogen peroxide (H2O2). Also involved in the conversion of iodide (I(-)) into hypoiodite (IO(-)) in the presence of H2O2. Responsible for the inactivation of a wide range of micro-organisms and hence, important component of defense mechanism (PubMed:12626341). Shows antibacterial properties against Pseudomonas aeruginosa (PubMed:12626341). The lactoperoxidase-SCN(-)-H2O2 system shows antibacterial properties against Burkholderia cepacia and Haemophilus influenzae in vitro (PubMed:12626341). Present in mammary and salivary gland secretions and may contribute to airway host defense against infection (PubMed:12626341). May contribute to maintaining an appropriate H2O2 cellular level, therefore protecting cells from H2O2-caused injuries and inflammation. [The UniProt Consortium]
Schlagworte: Anti-LPO, Anti-SPO, Anti-SAPX, Anti-Lactoperoxidase, Anti-Salivary peroxidase, Lactoperoxidase Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ6775

Eigenschaften

Anwendung: WB, IF
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids MFRLDENYQPWGPEPELPLHTLFFNTWRMVKD from the human protein
Format: Cellular & Oxid. Stress

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Lactoperoxidase"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen