Anti-Lactate Dehydrogenase (LD, LDHA, LDHB, LDH Heart Subunit, LDHH, LDH1, LDH Muscle Subunit, LDHM,

Anti-Lactate Dehydrogenase (LD, LDHA, LDHB, LDH Heart Subunit, LDHH, LDH1, LDH Muscle Subunit, LDHM,
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
128981.50 50 µg - -

9 - 20 Werktage*

850,00 €
 
Lactate dehydrogenase (LDH) contains two isoforms in mammals, LDH-M and LDH-H, which come... mehr
Produktinformationen "Anti-Lactate Dehydrogenase (LD, LDHA, LDHB, LDH Heart Subunit, LDHH, LDH1, LDH Muscle Subunit, LDHM,"
Lactate dehydrogenase (LDH) contains two isoforms in mammals, LDH-M and LDH-H, which come together to form a homotetramer of 36kD subunits. LDH is often as a marker for tissue breakdown or cytotoxicity. LDH shows cytoplasm localization. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 128981

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Format: Affinity Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Lactate Dehydrogenase (LD, LDHA, LDHB, LDH Heart Subunit, LDHH, LDH1, LDH Muscle Subunit, LDHM,"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen