Anti-KLF4

Anti-KLF4
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4437 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Kruppel-like factor 4, also known as EZF... mehr
Produktinformationen "Anti-KLF4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Kruppel-like factor 4, also known as EZF or GKLF, is a protein that in humans is encoded by the KLF4 gene. This gene is mapped to 9q31.2. KLF4 gene encodes a member of the Kruppel family of transcription factors. This gene plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. It is required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. This gene involved in the differentiation of epithelial cells and may also function in skeletal and kidney development. Protein function: Transcription factor, can act both as activator and as repressor. Binds the 5'-CACCC-3' core sequence. Binds to the promoter region of its own gene and can activate its own transcription. Regulates the expression of key transcription factors during embryonic development. Plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. Required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. Involved in the differentiation of epithelial cells and may also function in skeletal and kidney development. Contributes to the down-regulation of p53/TP53 transcription. [The UniProt Consortium]
Schlagworte: Anti-EZF, Anti-KLF4, Anti-Krueppel-like factor 4, Anti-Gut-enriched krueppel-like factor, Anti-Epithelial zinc finger protein EZF, KLF4 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4437

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids EKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLA
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-KLF4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen