Anti-KChIP2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59333.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating... mehr
Produktinformationen "Anti-KChIP2"
Protein function: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface. May be required for the expression of I(To) currents in the heart. [The UniProt Consortium]
Schlagworte: Anti-KCHIP2, Anti-KChIP2, Anti-KCNIP2, Anti-Kv channel-interacting protein 2, Anti-Potassium channel-interacting protein 2, Anti-A-type potassium channel modulatory protein 2, Anti-Cardiac voltage-gated potassium channel modulatory subunit
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59333

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: chicken)
Immunogen: Synthetic peptide corresponding to aa. 78-112 of Human KChIP2. (DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR)
MW: 31 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-KChIP2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen