| Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
|---|---|---|---|---|---|---|---|
| ARG59246.50 | 50 µl | - | - |
6 - 14 Werktage* |
584,00 €
|
| Schlagworte: | Anti-IRF9, Anti-IRF-9, Anti-ISGF3G, Anti-ISGF-3 gamma, Anti-ISGF3 p48 subunit, Anti-Interferon regulatory factor 9, Anti-Interferon-stimulated gene factor 3 gamma, Anti-Transcriptional regulator ISGF3 subunit gamma |
| Hersteller: | Arigo Biolaboratories |
| Hersteller-Nr: | ARG59246 |
Eigenschaften
| Anwendung: | IHC (paraffin), WB |
| Antikörper-Typ: | Polyclonal |
| Konjugat: | No |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human (Erwartet: mouse, rat, bovine, dog, guinea pig, horse, rabbit, zebrafish) |
| Immunogen: | Synthetic peptide around the N-terminal region of Human IRF9. (within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK) |
| MW: | 44 kD |
| Format: | Affinity Purified |
Datenbank Information
| KEGG ID : | K04693 | Passende Produkte |
| UniProt ID : | Q00978 | Passende Produkte |
| Gene ID : | GeneID 10379 | Passende Produkte |
Handhabung & Sicherheit
| Lagerung: | -20°C |
| Versand: | +4°C (International: °C) |
