Anti-IRF8

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40961.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Plays a role as a transcriptional activator or repressor (PubMed:25122610).... mehr
Produktinformationen "Anti-IRF8"
Protein function: Plays a role as a transcriptional activator or repressor (PubMed:25122610). Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Plays a negative regulatory role in cells of the immune system. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes. Positively regulates macroautophagy in dendritic cells (PubMed:29434592). [The UniProt Consortium]
Schlagworte: Anti-IRF8, Anti-ICSBP, Anti-IRF-8, Anti-ICSBP1, Anti-H-ICSBP, Anti-Interferon regulatory factor 8, Anti-Interferon consensus sequence-binding protein
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40961

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, cow, dog, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Human IRF8. (within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC)
MW: 48 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IRF8"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen