Anti-IRF5

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32219 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interferon regulatory factor 5, also... mehr
Produktinformationen "Anti-IRF5"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Protein function: Transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. Activated by TLR7 or TLR8 signaling. [The UniProt Consortium]
Schlagworte: Anti-IRF5, Anti-IRF-5, Anti-Interferon regulatory factor 5, IRF5 Antibody
Hersteller-Nr: R32219

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ of human IRF5 were used as the immunogen for the IRF5 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IRF5"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen