Anti-Involucrin

Anti-Involucrin
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31905 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Involucrin is a protein component of human... mehr
Produktinformationen "Anti-Involucrin"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath the plasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by the transglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms. Protein function: Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia. [The UniProt Consortium]
Schlagworte: Anti-IVL, Anti-Involucrin, Involucrin Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31905

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK of human Involucrin were used as the immunogen for the Involucrin antibody.
Format: Purified

Datenbank Information

UniProt ID : P07476 | Passende Produkte
Gene ID : GeneID 3713 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Involucrin"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen