Anti-IL28RA

Anti-IL28RA
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41102.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3... mehr
Produktinformationen "Anti-IL28RA"
Protein function: The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus- activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. [The UniProt Consortium]
Schlagworte: Anti-LICR2, Anti-IL28RA, Anti-IFNLR1, Anti-CRF2-12, Anti-IL-28RA, Anti-IL-28R-alpha, Anti-IFN-lambda-R1, Anti-IFN-lambda receptor 1, Anti-Interferon lambda receptor 1, Anti-IL-28 receptor subunit alpha, Anti-Cytokine receptor family 2 member 12
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41102

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human IL28RA. (within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF)
MW: 58 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IL28RA"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen