Anti-IGFBP2

Anti-IGFBP2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG10674.50 50 µg - -

6 - 14 Werktage*

559,00 €
 
Protein function: Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins... mehr
Produktinformationen "Anti-IGFBP2"
Protein function: Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. [The UniProt Consortium]
Schlagworte: Anti-BP2, Anti-IBP-2, Anti-IGFBP2, Anti-IGFBP-2, Anti-IGF-binding protein 2, Anti-Insulin-like growth factor-binding protein 2
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG10674

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Synthetic peptide corresponding to the sequence at a.a 228-257 (QQELDQVLERISTMRLPDERGPLEHLYSLH) around the C-terminus of human IGFBP2 protein
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IGFBP2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen