Anti-IGFBP1

Anti-IGFBP1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32108 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. IGFBP1, Insulin-like growth factor-binding... mehr
Produktinformationen "Anti-IGFBP1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Protein function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration. [The UniProt Consortium]
Schlagworte: Anti-IBP-1, Anti-Igfbp1, Anti-Igfbp-1, Anti-IGFBP-1, Anti-IGF-binding protein 1, Anti-Insulin-like growth factor-binding protein 1, IGFBP1 Antibody
Hersteller-Nr: R32108

Eigenschaften

Anwendung: WB, ELISA
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Mouse, Rat
Immunogen: Amino acids REIADLKKWKEPCQRELYKVLERLAAAQQKA of mouse IGFBP1 were used as the immunogen for the IGFBP1antibody.
Format: Purified

Datenbank Information

UniProt ID : P47876 | Suche mit UniProt ID
Gene ID GeneID 16006 | Suche mit Gene ID

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IGFBP1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen