Anti-ICA1

Anti-ICA1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32190 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Islet cell autoantigen 1 is a protein that... mehr
Produktinformationen "Anti-ICA1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. Protein function: May play a role in neurotransmitter secretion. [The UniProt Consortium]
Schlagworte: Anti-p69, Anti-ICA1, Anti-ICA69, Anti-ICAp69, Anti-Islet cell autoantigen 1, Anti-Islet cell autoantigen p69, Anti-69 kDa islet cell autoantigen, ICA1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32190

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ICA1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen