Anti-HSD11B2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32170 100 µg - -

3 - 10 Werktage

503,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Corticosteroid 11-beta-dehydrogenase... mehr
Produktinformationen "Anti-HSD11B2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Corticosteroid 11-beta-dehydrogenase isozyme 2, also known as 11-beta-hydroxysteroid dehydrogenase 2, is an enzyme that in humans is encoded by the HSD11B2 gene. There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension. Protein function: Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. [The UniProt Consortium]
Schlagworte: Anti-11-DH2, Anti-HSD11B2, EC=1.1.1.-, Anti-11-beta-HSD, Anti-11-beta-HSD2, Anti-11-HSD type II, Anti-11-beta-HSD type II, Anti-11-beta-hydroxysteroid dehydrogenase type 2, Anti-11-beta-hydroxysteroid dehydrogenase type II, HSD11B2 Antibody
Hersteller-Nr: R32170

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Wirt: Rabbit
Reaktivität: Human, Mouse, Rat
Immunogen: Amino acids EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH of human HSD11B2 were used as the immunogen for the HSD11B2 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-HSD11B2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen