Anti-HLA-DQB1

Anti-HLA-DQB1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4155 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Major histocompatibility complex, class... mehr
Produktinformationen "Anti-HLA-DQB1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Major histocompatibility complex, class II, DQ beta 1, also known as HLA-DQB1, is a human gene and also denotes the genetic locus that contains this gene. HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants.
Schlagworte: Anti-HLA-DQB, Anti-HLA-DQB1, Anti-MHC class II antigen DQB1, Anti-HLA class II histocompatibility antigen, DQ beta 1 chain, HLA-DQB1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4155

Eigenschaften

Anwendung: WB, IF, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids DAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR were used as the immunogen for the HLA-DQB1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-HLA-DQB1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen