Anti-HCN2

Anti-HCN2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32802 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Potassium/sodium... mehr
Produktinformationen "Anti-HCN2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated ion channel 2 is a protein that in humans is encoded by the HCN2 gene. The HCN2 gene is localized on human chromosome 19p13.3 and contains eight exons spanning approximately 27 kb. Hyperpolarization-activated cation channels of the HCN gene family, such as HCN2, contribute to spontaneous rhythmic activity in both heart and brain. Protein function: Hyperpolarization-activated ion channel exhibiting weak selectivity for potassium over sodium ions. Contributes to the native pacemaker currents in heart (If) and in neurons (Ih). Can also transport ammonium in the distal nephron. Produces a large instantaneous current. Modulated by intracellular chloride ions and pH, acidic pH shifts the activation to more negative voltages. [The UniProt Consortium]
Schlagworte: Anti-HCN2, Anti-BCNG2, Anti-BCNG-2, Anti-Brain cyclic nucleotide-gated channel 2, Anti-Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2, HCN2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32802

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat
Immunogen: Amino acids 682-714 (VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-HCN2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen