Anti-HAS1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40286.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent... mehr
Produktinformationen "Anti-HAS1"
Protein function: Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction. Also able to catalyze the synthesis of chito- oligosaccharide depending on the substrate. [The UniProt Consortium]
Schlagworte: Anti-HAS, Anti-HAS1, Anti-HuHAS1, EC=2.4.1.212, Anti-HA synthase 1, Anti-Hyaluronan synthase 1, Anti-Hyaluronate synthase 1, Anti-Hyaluronic acid synthase 1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40286

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human HAS1. (NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)
MW: 65 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-HAS1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen