Anti-GSTM1

Anti-GSTM1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4036 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glutathione S-transferase Mu 1 (gene name... mehr
Produktinformationen "Anti-GSTM1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Glutathione S-transferase Mu 1 (gene name GSTM1) is a human glutathione S-transferase. Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene. Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. [The UniProt Consortium]
Schlagworte: Anti-GTH4, Anti-GST1, Anti-GSTM1, Anti-GSTM1-1, Anti-GSTM1a-1a, Anti-GSTM1b-1b, EC=2.5.1.18, Anti-GST class-mu 1, Anti-GST HB subunit 4, Anti-Glutathione S-transferase Mu 1, GSTM1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4036

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat
Immunogen: Amino acids EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK from the human protein were used as the immunogen for the GSTM1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GSTM1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen