Anti-GRK6

Anti-GRK6
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58831.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Specifically phosphorylates the activated forms of G protein-coupled receptors.... mehr
Produktinformationen "Anti-GRK6"
Protein function: Specifically phosphorylates the activated forms of G protein-coupled receptors. Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their desensitization. Seems to be involved in the desensitization of D2-like dopamine receptors in striatum and chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor: LRP6 during Wnt signaling (in vitro). [The UniProt Consortium]
Schlagworte: Anti-GRK6, Anti-GPRK6, EC=2.7.11.16, Anti-G protein-coupled receptor kinase 6, Anti-G protein-coupled receptor kinase GRK6
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58831

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat (Erwartet: bovine)
Immunogen: Synthetic peptide corresponding to aa. 382-417 of Human GRK6 (QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR)
MW: 66 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GRK6"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen