Anti-GOT2 (Glutamic-oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2), Aspart

Anti-GOT2 (Glutamic-oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2), Aspart
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
127474.100 100 µg - -

5 - 10 Werktage*

850,00 €
 
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in... mehr
Produktinformationen "Anti-GOT2 (Glutamic-oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2), Aspart"
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 127474

Eigenschaften

Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 4H8
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant corresponding to aa331-430 from human GOT2 (NP_002071) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GOT2 (Glutamic-oxaloacetic Transaminase 2, Mitochondrial (Aspartate Aminotransferase 2), Aspart"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen