| Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
|---|---|---|---|---|---|---|---|
| ARG58934.50 | 50 µl | - | - |
6 - 14 Werktage* |
584,00 €
|
| Schlagworte: | Anti-GNAZ, Anti-Gz-alpha, Anti-G(x) alpha chain, Anti-Guanine nucleotide-binding protein G(z) subunit alpha |
| Hersteller: | Arigo Biolaboratories |
| Hersteller-Nr: | ARG58934 |
Eigenschaften
| Anwendung: | WB |
| Antikörper-Typ: | Polyclonal |
| Konjugat: | No |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human (Erwartet: mouse, rat, bovine, dog, guinea pig, horse, rabbit) |
| Immunogen: | Synthetic peptide around the N-terminal region of Human GNAZ. (within the following region: LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT) |
| MW: | 40 kD |
| Format: | Affinity Purified |
Datenbank Information
| KEGG ID : | K04535 | Passende Produkte |
| UniProt ID : | P19086 | Passende Produkte |
| Gene ID : | GeneID 2781 | Passende Produkte |
Handhabung & Sicherheit
| Lagerung: | -20°C |
| Versand: | +4°C (International: °C) |
