Anti-GCM1

Anti-GCM1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41256.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: Transcription factor that is necessary for placental development... mehr
Produktinformationen "Anti-GCM1"
Protein function: Transcription factor that is necessary for placental development (PubMed:8962155). Involved in the control of expression of placental growth factor (PGF) and other placenta- specific genes. Binds to the trophoblast-specific element 2 (TSE2) of the aromatase gene enhancer. Binds to the SYDE1 promoter. Has a central role in mediating the differentiation of trophoblast cells along both the villous and extravillous pathways in placental development. [The UniProt Consortium]
Schlagworte: Anti-Gcm1, Anti-Gcma, Anti-mGCMa, Anti-mGCM1, Anti-GCM motif protein 1, Anti-Glial cells missing homolog 1, Anti-Chorion-specific transcription factor GCMa
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41256

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse (Erwartet: human, rat, cow, dog, guinea pig, horse, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Mouse GCM1. (within the following region: KEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWA)
MW: 49 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GCM1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen