Anti-GCM1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40417.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: Transcription factor involved in the control of expression of placental growth... mehr
Produktinformationen "Anti-GCM1"
Protein function: Transcription factor involved in the control of expression of placental growth factor (PGF) and other placenta- specific genes (PubMed:10542267, PubMed:18160678). Binds to the trophoblast-specific element 2 (TSE2) of the aromatase gene enhancer (PubMed:10542267). Binds to the SYDE1 promoter (PubMed:27917469). Has a central role in mediating the differentiation of trophoblast cells along both the villous and extravillous pathways in placental development (PubMed:19219068). [The UniProt Consortium]
Schlagworte: Anti-GCM1, Anti-GCMA, Anti-hGCMa, Anti-GCM motif protein 1, Anti-Glial cells missing homolog 1, Anti-Chorion-specific transcription factor GCMa
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40417

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, dog)
Immunogen: Synthetic peptide around the N-terminal region of Human GCM1 (within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK)
MW: 49 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GCM1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen