Anti-GCLC (Glutamate-cysteine Ligase Catalytic Subunit, GCL, GLCL, GLCLC, Gamma-glutamylcysteine Syn

Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. The gene for catalytic subunit (GLCLC) encodes a protein of 367aa with a calculated molecular weight of 72.773kD and maps to chromosome 6. The regulatory subunit is derived from a different gene located on chromosome 1p21-p22. GLCLC deficiency in human is associated with enzymopathic hemolytic anemia. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.