Anti-gamma Crystallin C

Anti-gamma Crystallin C
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58547.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: Crystallins are the dominant structural components of the vertebrate eye lens.... mehr
Produktinformationen "Anti-gamma Crystallin C"
Protein function: Crystallins are the dominant structural components of the vertebrate eye lens. [The UniProt Consortium]
Schlagworte: Anti-CRYGC, Anti-CRYG3, Anti-Gamma-crystallin C, Anti-Gamma-crystallin 3, Anti-Gamma-C-crystallin, Anti-Gamma-crystallin 2-1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58547

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: bovine, rat, dog, horse, rabbit)
Immunogen: Synthetic peptide around the middle region of Human gamma Crystallin C. (within the following sequence: GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE)
MW: 21 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-gamma Crystallin C"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen