Anti-Galectin-3 (GAL3, Carbohydrate Binding Protein 35, CBP35, Galactose Specific Lectin 3, Galactos

Anti-Galectin-3 (GAL3, Carbohydrate Binding Protein 35, CBP35, Galactose Specific Lectin 3, Galactos
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
127121.100 100 µl - -

3 - 19 Werktage*

943,00 €
 
Lectins are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the... mehr
Produktinformationen "Anti-Galectin-3 (GAL3, Carbohydrate Binding Protein 35, CBP35, Galactose Specific Lectin 3, Galactos"
Lectins are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with betagalactoside moieties. Galactin-3 regulates a number of biological processes, including embryogenesis, inflammatory responses, cell progression and metastasis. Galectin-3 can function intracellularly in controlling cell cycle and preventing T-cell apoptosis, and also extracellularly, in activating various cells, including monocytes/macrophages, mast cells, neutrophils, and lymphocytes. Human Galectin-3 is a globular 26kD protein containing 250aa residues. Applications: Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 127121

Eigenschaften

Anwendung: IP, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
Immunogen: Full length human LGALS3, aa1-250 (AAH53667.1).
Reinheit: Serum
Format: Serum

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Galectin-3 (GAL3, Carbohydrate Binding Protein 35, CBP35, Galactose Specific Lectin 3, Galactos"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen