Anti-GADD45A

Anti-GADD45A
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32429 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Growth arrest and DNA-damage-inducible... mehr
Produktinformationen "Anti-GADD45A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Growth arrest and DNA-damage-inducible protein GADD45 alpha (GADD45A) is a protein that in humans is encoded by the GADD45A gene. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. It is located on 1p34-p12. Sequence analysis of human and hamster cDNA clones demonstrated that the gene has been highly conserved and encodes a novel 165-amino acid polypeptide. Northern blot analysis detected moderate expression of a 1.4-kb GADD45A transcript in heart, skeletal muscle, and kidney, with little or no expression in brain, placenta, lung, liver, and pancreas. In addition, Gadd45a promotes epigenetic gene activation by repair-mediated DNA demethylation. Protein function: In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity. Might affect PCNA interaction with some CDK (cell division protein kinase) complexes, stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. [The UniProt Consortium]
Schlagworte: Anti-DDIT1, Anti-DDIT-1, Anti-GADD45A, Anti-DNA damage-inducible transcript 1 protein, Anti-Growth arrest and DNA damage-inducible protein GADD45 alpha, GADD45A Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32429

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER were used as the immunogen for the GADD45A antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GADD45A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen