Anti-FMO5

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58755.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: In contrast with other forms of FMO it does not seem to be a drug-metabolizing... mehr
Produktinformationen "Anti-FMO5"
Protein function: In contrast with other forms of FMO it does not seem to be a drug-metabolizing enzyme. [The UniProt Consortium]
Schlagworte: Anti-FMO5, Anti-FMO 5, EC=1.14.13.8, Anti-Dimethylaniline oxidase 5, Anti-Hepatic flavin-containing monooxygenase 5, Anti-Dimethylaniline monooxygenase [N-oxide-forming] 5
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58755

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, bovine, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the middle region of Human FMO5. (within the following sequence: NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN)
MW: 59 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FMO5"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen