Anti-FMO2

Anti-FMO2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58712.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an... mehr
Produktinformationen "Anti-FMO2"
Protein function: Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an N-hydroxylamine intermediate. Inactive toward certain tertiary amines, such as imipramine or chloropromazine. Can catalyze the S-oxidation of methimazole. [The UniProt Consortium]
Schlagworte: Anti-FMO2, Anti-FMO 2, Anti-FMO 1B1, EC=1.14.13.8, Anti-Dimethylaniline oxidase 2, Anti-Pulmonary flavin-containing monooxygenase 2, Anti-Dimethylaniline monooxygenase [N-oxide-forming] 2
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58712

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide corresponding to aa. 78-115 of Human FMO2 (FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK)
MW: 54 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FMO2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen