Anti-Filamin C

Anti-Filamin C
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG56858.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Muscle-specific filamin, which plays a central role in muscle cells, probably... mehr
Produktinformationen "Anti-Filamin C"
Protein function: Muscle-specific filamin, which plays a central role in muscle cells, probably by functioning as a large actin-cross- linking protein. May be involved in reorganizing the actin cytoskeleton in response to signaling events, and may also display structural functions at the Z lines in muscle cells. Critical for normal myogenesis and for maintaining the structural integrity of the muscle fibers. [The UniProt Consortium]
Schlagworte: Anti-FLNc, Anti-FLNC, Anti-ABPL, Anti-ABP-L, Anti-FLN-C, Anti-Filamin-2, Anti-Filamin-C, Anti-Gamma-filamin, Anti-ABP-280-like protein, Anti-Actin-binding-like protein
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG56858

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: cow, dog, guinea pig, horse, mouse, rabbit, rat, zebrafish)
Immunogen: Synthetic peptide around the N-terminus of Human Filamin C. (VGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEP)
MW: 296 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Filamin C"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen