Anti-FGF9

Anti-FGF9
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4461 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FGF 9, Fibroblast growth factor 9, is a... mehr
Produktinformationen "Anti-FGF9"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FGF 9, Fibroblast growth factor 9, is a protein that in humans is encoded by the FGF9 gene. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. The FGF 9 gene contains 3 exons. By radioactive chromosomal in situ hybridization, the FGF 9 gene is mapped to chromosome 13q11-q12. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Protein function: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. [The UniProt Consortium]
Schlagworte: Anti-GAF, Anti-FGF9, Anti-FGF-9, Anti-HBGF-9, Anti-Glia-activating factor, Anti-Fibroblast growth factor 9, Anti-Heparin-binding growth factor 9, FGF9 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4461

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FGF9"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen