Anti-FGF9

Anti-FGF9
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41395.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Plays an important role in the regulation of embryonic development, cell... mehr
Produktinformationen "Anti-FGF9"
Protein function: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. [The UniProt Consortium]
Schlagworte: Anti-GAF, Anti-FGF9, Anti-FGF-9, Anti-HBGF-9, Anti-Glia-activating factor, Anti-Fibroblast growth factor 9, Anti-Heparin-binding growth factor 9
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41395

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human FGF9 (DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY)
MW: 23 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FGF9"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen