Anti-FASN (Fatty Acid Synthase, FAS, MGC14367, MGC15706, OA-519, SDR27X1)

Anti-FASN (Fatty Acid Synthase, FAS, MGC14367, MGC15706, OA-519, SDR27X1)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
245988.100 100 µg - -

9 - 20 Werktage*

850,00 €
 
The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze... mehr
Produktinformationen "Anti-FASN (Fatty Acid Synthase, FAS, MGC14367, MGC15706, OA-519, SDR27X1)"
The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha. [provided by RefSeq, Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSTNDTIVSGTLPQRMASCLEVLDLFLNQPHMVLSSFVLAEKMouse monoclonal antibody raised against a full length recombinant FASN.YRDRDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSVEVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASGLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVMouse monoclonal antibody raised against a full length recombinant FASN.VDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 245988

Eigenschaften

Anwendung: ELISA, IF, WB
Antikörper-Typ: Monoclonal
Klon: 3B3-1D6
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: FASN (AAH07909, 1aa-439aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FASN (Fatty Acid Synthase, FAS, MGC14367, MGC15706, OA-519, SDR27X1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen