Anti-Fascin

Anti-Fascin
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32251 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Organizes filamentous actin into bundles... mehr
Produktinformationen "Anti-Fascin"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration. [UniProt]Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer. Protein function: Actin-binding protein that contains 2 major actin binding sites (PubMed:21685497, PubMed:23184945). Organizes filamentous actin into parallel bundles (PubMed:20393565, PubMed:21685497, PubMed:23184945). Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers (PubMed:22155786). Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration (PubMed:20393565, PubMed:21685497, PubMed:23184945). Mediates reorganization of the actin cytoskeleton and axon growth cone collapse in response to NGF (PubMed:22155786). [The UniProt Consortium]
Schlagworte: Anti-p55, Anti-FAN1, Anti-FSCN1, Anti-Fascin, Anti-Singed-like protein, Anti-55 kDa actin-bundling protein, Fascin Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32251

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD of human Fascin
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Fascin"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen