Anti-FABP2 (intestinal)

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32378 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FABP are thought to play a role in the... mehr
Produktinformationen "Anti-FABP2 (intestinal)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor. [UniProt] Protein function: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long- chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor. [The UniProt Consortium]
Schlagworte: Anti-FABPI, Anti-FABP2, Anti-I-FABP, Anti-Fatty acid-binding protein 2, Anti-Fatty acid-binding protein, intestinal, Anti-Intestinal-type fatty acid-binding protein, FABP2 Antibody (intestinal)
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32378

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK from the human protein were used as the immunogen for the FABP2 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FABP2 (intestinal)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen