Anti-ETS1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58613.50 50 µl - -

6 - 14 Werktage*

520,00 €
 
Protein function: Transcription factor. Directly controls the expression of cytokine and... mehr
Produktinformationen "Anti-ETS1"
Protein function: Transcription factor. Directly controls the expression of cytokine and chemokine genes in a wide variety of different cellular contexts. May control the differentiation, survival and proliferation of lymphoid cells. May also regulate angiogenesis through regulation of expression of genes controlling endothelial cell migration and invasion. [The UniProt Consortium]
Schlagworte: Anti-p54, Anti-ETS1, Anti-EWSR2, Anti-Protein C-ets-1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58613

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, bovine, dog, goat, guinea pig, horse, rabbit, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Human ETS1. (within the following sequence: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN)
MW: 50 kD
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ETS1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen