Anti-eRF1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58612.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Directs the termination of nascent peptide synthesis (translation) in response... mehr
Produktinformationen "Anti-eRF1"
Protein function: Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA (PubMed:7990965, PubMed:24486019). Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. [The UniProt Consortium]
Schlagworte: Anti-ERF1, Anti-ETF1, Anti-eRF1, Anti-TB3-1, Anti-Protein Cl1, Anti-Eukaryotic release factor 1, Anti-Eukaryotic peptide chain release factor subunit 1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58612

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, bovine, dog, guinea pig, horse, rabbit, yeast, zebrafish)
Immunogen: Synthetic peptide around the N-terminal region of Human eRF1. (within the following sequence: ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL)
MW: 49 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-eRF1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen