Anti-ENO2 (Gamma-enolase, 2-phospho-D-glycerate hydro-lyase, Enolase 2, Neural Enolase, Neuron-speci

Anti-ENO2 (Gamma-enolase, 2-phospho-D-glycerate hydro-lyase, Enolase 2, Neural Enolase, Neuron-speci
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
126332.100 100 µg - -

3 - 19 Werktage*

850,00 €
 
Enolase is a glycolytic enzyme catalyzing the reaction pathway between 2 phospho glycerate and... mehr
Produktinformationen "Anti-ENO2 (Gamma-enolase, 2-phospho-D-glycerate hydro-lyase, Enolase 2, Neural Enolase, Neuron-speci"
Enolase is a glycolytic enzyme catalyzing the reaction pathway between 2 phospho glycerate and phosphoenol pyruvate. In mammals, enolase molecules are dimers composed of three distinct subunits (alpha, beta and gamma). The alpha subunit is expressed in most tissues and the beta subunit only in muscle. The gamma subunit is expressed primarily in neurons, in normal and in neoplastic neuroendocrine cells. NSE (neuron specific enolase) is found in elevated concentrations in plasma and certain neoplasias. These include pediatric neuroblastoma and small cell lung cancer. Coexpression of NSE and chromogranin A is common in neuroendocrine neoplasms. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNPSVL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 126332

Eigenschaften

Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 1A3
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant corresponding to aa325-434 from human ENO2 (AAH02745) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ENO2 (Gamma-enolase, 2-phospho-D-glycerate hydro-lyase, Enolase 2, Neural Enolase, Neuron-speci"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen