Anti-Emerin, clone 5A10

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58577.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Stabilizes and promotes the formation of a nuclear actin cortical network.... mehr
Produktinformationen "Anti-Emerin, clone 5A10"
Protein function: Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta-catenin activity by preventing its accumulation in the nucleus. Acts by influencing the nuclear accumulation of beta- catenin through a CRM1-dependent export pathway. Links centrosomes to the nuclear envelope via a microtubule association. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD. Required for proper localization of non-farnesylated prelamin-A/C. [The UniProt Consortium]
Schlagworte: Anti-EMD, Anti-EDMD, Anti-Emerin
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58577

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Monoclonal
Klon: 5A10
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Synthetic peptide corresponding to aa. 1-48 of Human Emerin. (MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL)
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Emerin, clone 5A10"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen