Anti-DGAT1

Anti-DGAT1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31838 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Acyl-CoA: diacylglycerol acyltransferase 1... mehr
Produktinformationen "Anti-DGAT1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Acyl-CoA: diacylglycerol acyltransferase 1 (DGAT1) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates. DGAT had been considered necessary for adipose tissue formation and essential for survival. There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2. DGAT1 is a host factor for HCV infection that binds core protein, localizes it to DGAT1-generated lipid droplets, and recruits viral RNA replication complexes for viral assembly. DGAT2-generated lipid droplets formed normally in cells treated with the DGAT1 inhibitor, suggesting that DGAT1 inhibitors may be useful as antiviral therapeutics. Protein function: Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders. [The UniProt Consortium]
Schlagworte: Anti-ARAT, Anti-AGRP1, Anti-DGAT1, Anti-ACAT-related gene product 1, Anti-Diglyceride acyltransferase, Anti-Retinol O-fatty-acyltransferase, Anti-Diacylglycerol O-acyltransferase 1, Anti-Acyl-CoA retinol O-fatty-acyltransferase, DGAT1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31838

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR of human DGAT1 were used as the immunogen for the DGAT antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-DGAT1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen