Anti-DDAH1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32437 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. DDAH1 is knowns as dimethylarginine... mehr
Produktinformationen "Anti-DDAH1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney. Protein function: Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation. [The UniProt Consortium]
Schlagworte: Anti-DDAH, Anti-DDAHI, Anti-DDAH1, Anti-DDAH-1, EC=3.5.3.18, Anti-Dimethylargininase-1, Anti-Dimethylarginine dimethylaminohydrolase 1, Anti-N(G),N(G)-dimethylarginine dimethylaminohydrolase 1, DDAH1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32437

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-DDAH1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen