Anti-DAP1 (Death-associated Protein 1, DAP-1, DAP)

Death Associated Protein 1 (DAP1) is a 15kD protein that functions as a positive mediator of cell death initiated by interferon-gamma. The DAP1 protein is proline-rich and possesses one SH3 binding motif, as well as several consensus protein kinase phosphorylation sites. The protein is localized in the cytoplasm, however the detailed mechanism of its proapoptotic function is unclear. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.