Anti-Cytokeratin 19, clone 3D4

Anti-Cytokeratin 19, clone 3D4
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4521 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Keratin, type I cytoskeletal 19 is a... mehr
Produktinformationen "Anti-Cytokeratin 19, clone 3D4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood. Protein function: Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle. [The UniProt Consortium]
Schlagworte: Anti-K19, Anti-CK-19, Anti-KRT19, Anti-Keratin-19, Anti-Cytokeratin-19, Anti-Keratin, type I cytoskeletal 19, Cytokeratin 19 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4521

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Monoclonal
Klon: 3D4
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Amino acids QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Cytokeratin 19, clone 3D4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen