Anti-Cytokeratin 19

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40282.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Involved in the organization of myofibers. Together with KRT8, helps to link... mehr
Produktinformationen "Anti-Cytokeratin 19"
Protein function: Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle. [The UniProt Consortium]
Schlagworte: Anti-K19, Anti-KRT19, Anti-CK-19, Anti-Keratin-19, Anti-Cytokeratin-19, Anti-Keratin, type I cytoskeletal 19
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40282

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 334-372 of Human Cytokeratin 19. (QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR)
MW: 44 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Cytokeratin 19"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen