Anti-CYP27B1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31812 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CYP27B1 belongs to the cytochrome P450... mehr
Produktinformationen "Anti-CYP27B1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CYP27B1 belongs to the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I. Protein function: Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D) to 1-alpha,25-dihydroxyvitamin D3 (1,25(OH)2D) plays an important role in normal bone growth, calcium metabolism, and tissue differentiation. [The UniProt Consortium]
Schlagworte: Anti-CYP27B1, Anti-CYP1ALPHA, EC=1.14.13.13, Anti-VD3 1A hydroxylase, Anti-Cytochrome p450 27B1, Anti-Cytochrome P450C1 alpha, Anti-Cytochrome P450VD1-alpha, Anti-Calcidiol 1-monooxygenase, Anti-25-OHD-1 alpha-hydroxylase, CYP27B1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31812

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR of human CYP27B1 were used as the immunogen for the CYP27B1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CYP27B1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen