Anti-CYP27B1

Anti-CYP27B1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG42954.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: A cytochrome P450 monooxygenase involved in vitamin D metabolism and in calcium... mehr
Produktinformationen "Anti-CYP27B1"
Protein function: A cytochrome P450 monooxygenase involved in vitamin D metabolism and in calcium and phosphorus homeostasis. Catalyzes the rate-limiting step in the activation of vitamin D in the kidney, namely the hydroxylation of 25-hydroxyvitamin D3/calcidiol at the C1alpha- position to form the hormonally active form of vitamin D3, 1alpha,25- dihydroxyvitamin D3/calcitriol that acts via the vitamin D receptor (VDR) (PubMed:10518789, PubMed:9486994, PubMed:22862690, PubMed:10566658, PubMed:12050193). Has 1alpha-hydroxylase activity on vitamin D intermediates of the CYP24A1-mediated inactivation pathway (PubMed:10518789, PubMed:22862690). Converts 24R,25-dihydroxyvitamin D3/secalciferol to 1-alpha,24,25-trihydroxyvitamin D3, an active ligand of VDR. Also active on 25-hydroxyvitamin D2 (PubMed:10518789). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via FDXR/adrenodoxin reductase and FDX1/adrenodoxin (PubMed:22862690). {ECO:0000269, PubMed:10518789, ECO:0000269, PubMed:10566658, ECO:0000269, PubMed:12050193, ECO:0000269, PubMed:22862690, ECO:0000269, PubMed:9486994}. [The UniProt Consortium]
Schlagworte: Anti-CYP27B1, Anti-CYP1ALPHA, Anti-VD3 1A hydroxylase, Anti-VD3 1A hydroxylase, Anti-Cytochrome p450 27B1, Anti-Cytochrome p450 27B1, Anti-Cytochrome P450C1 alpha, Anti-Cytochrome P450C1 alpha, Anti-Cytochrome P450VD1-alpha, Anti-Cytochrome P450VD1-alpha,
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG42954

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 475-508 of Human CYP27B1. (HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR)
MW: 57 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CYP27B1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen