Anti-CTNS

Anti-CTNS
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59641.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an... mehr
Produktinformationen "Anti-CTNS"
Protein function: Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an important role in melanin synthesis, possibly by preventing melanosome acidification and subsequent degradation of tyrosinase TYR. [The UniProt Consortium]
Schlagworte: Anti-Ctns, Anti-Cystinosin
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59641

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse (Erwartet: human, rat, bovine, dog, horse, swine, rabbit)
Immunogen: Synthetic peptide around the middle region of Mouse CTNS. (within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP)
MW: 42 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CTNS"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen