Anti-CPT1B

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32293 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CPT1B is located on 22q13.33. The protein... mehr
Produktinformationen "Anti-CPT1B"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.
Schlagworte: Anti-CPT I, Anti-CPT1B, Anti-CPT1-M, Anti-CPTI-M, Anti-KIAA1670, Anti-Carnitine palmitoyltransferase 1B, Anti-Carnitine palmitoyltransferase I-like protein, Anti-Carnitine O-palmitoyltransferase 1, muscle isoform, Anti-Carnitine O-palmitoyltransferase I,
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32293

Eigenschaften

Anwendung: WB, IHC (paraffin), (IF), IF
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids DDEEYYRMELLAKEFQDKTAPRLQKYLVLK of human CPT1B
Format: Metabolism

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CPT1B"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen