Anti-CELA3A (ELA3, ELA3A, Chymotrypsin-like Elastase Family Member 3A, Elastase IIIA, Elastase-3A, P

Anti-CELA3A (ELA3, ELA3A, Chymotrypsin-like Elastase Family Member 3A, Elastase IIIA, Elastase-3A, P
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
124839.100 100 µg - -

5 - 10 Werktage*

850,00 €
 
Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to... mehr
Produktinformationen "Anti-CELA3A (ELA3, ELA3A, Chymotrypsin-like Elastase Family Member 3A, Elastase IIIA, Elastase-3A, P"
Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3A has little elastolytic activity. Like most of the human elastases, elastase 3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3A preferentially cleaves proteins after alanine residues. Elastase 3A may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 124839

Eigenschaften

Anwendung: ELISA, IHC, WB
Antikörper-Typ: Monoclonal
Klon: 3G4
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Format: Affinity Purified

Datenbank Information

UniProt ID : P09093 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CELA3A (ELA3, ELA3A, Chymotrypsin-like Elastase Family Member 3A, Elastase IIIA, Elastase-3A, P"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen