Anti-CD74 (HLA Class II Histocompatibility Antigen gamma Chain, HLA-DR Antigens-associated Invariant

CD74 is a type II transmembrane glycoprotein, also known as MHC Class II associated invariant chain, invariant chain, Ii, MHC class II chaperone, or MIF receptor. CD74 exists in 4 isoforms with the molecular sizes 33, 35, 41, and 43kD depending on genetic splicing. CD74 is primarily expressed on antigen presenting cells, including B cells, monocytes/macrophages, dendritic cells, and Langerhans cells. It is also expressed by activated T cells, activated endothelial and epithelial cells as well as the carcinomas of lung, renal, gastric and thymic origin. The primary function of CD74 is for intracellular sorting of the MHC class II molecules, regulation of loading exogenous peptides onto MHC class II. It is also involved in the modulation of B cell differentiation and positive selection of CD4+ T cells. It has been reported that CD74 binds MIF (macrophage migration inhibitory factory) and signaling through CD44 to regulate innate and adaptive immunity, and that the H. pylori infection is through urease B binding CD74 on gastric epithelial cells and inducing cell activation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.